PDB entry 3cpf

View 3cpf on RCSB PDB site
Description: Crystal structure of human eukaryotic translation initiation factor EIF5A
Class: cell cycle
Keywords: Structural Genomics Consortium, leukemia, apoptosis, SGC, Hypusine, Initiation factor, Nucleus, Protein biosynthesis, CELL CYCLE
Deposited on 2008-03-31, released 2008-04-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.246
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Eukaryotic translation initiation factor 5A-1
    Species: Homo sapiens [TaxId:9606]
    Gene: EIF5A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cpfa1, d3cpfa2
  • Chain 'B':
    Compound: Eukaryotic translation initiation factor 5A-1
    Species: Homo sapiens [TaxId:9606]
    Gene: EIF5A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cpfb1, d3cpfb2
  • Heterogens: UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cpfA (A:)
    gsatfpmqcsalrkngfvvlkgrpckivemstsktgkhghakvhlvgidiftgkkyedic
    psthnmdvpnikrndfqligiqdgylsllqdsgevredlrlpegdlgkeieqkydcgeei
    litvlsamteeaavaika
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cpfA (A:)
    satfpmqcsalrkngfvvlkgrpckivemstskthakvhlvgidiftgkkyedicpsthn
    mdvpnikrndfqligiqdgylsllqdsgevredlrlpegdlgkeieqkydcgeeilitvl
    samteeaavaik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cpfB (B:)
    gsatfpmqcsalrkngfvvlkgrpckivemstsktgkhghakvhlvgidiftgkkyedic
    psthnmdvpnikrndfqligiqdgylsllqdsgevredlrlpegdlgkeieqkydcgeei
    litvlsamteeaavaika
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cpfB (B:)
    satfpmqcsalrkngfvvlkgrpckivemsvhlvgidiftgkkyedicpsthnmdvpnik
    rndfqligiqdgylsllqdsgevredlrlpegdlgkeieqkydcgeeilitvlsamteea
    avaika