PDB entry 3cpa

View 3cpa on RCSB PDB site
Description: x-ray crystallographic investigation of substrate binding to carboxypeptidase a at subzero temperature
Class: hydrolase (c-terminal peptidase)
Keywords: hydrolase (c-terminal peptidase)
Deposited on 1982-03-24, released 1982-07-29
The last revision prior to the SCOP 1.73 freeze date was dated 1987-01-15, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxypeptidase a
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00730 (0-306)
      • conflict (27)
      • conflict (30)
      • conflict (88)
      • conflict (92)
      • conflict (113)
      • conflict (121)
      • conflict (184)
      • conflict (227)
      • conflict (304)
    Domains in SCOP 1.73: d3cpaa_
  • Chain 'S':
    Compound: glycyl-l-tyrosine
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cpaA (A:)
    arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
    senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnn
    

  • Chain 'S':
    No sequence available.