PDB entry 3cp4

View 3cp4 on RCSB PDB site
Description: crystal structure of the cytochrome p450-cam active site mutant thr252ala
Deposited on 1991-06-04, released 1993-01-15
The last revision prior to the SCOP 1.55 freeze date was dated 1993-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.163
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d3cp4__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cp4_ (-)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
    ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav