PDB entry 3cp1

View 3cp1 on RCSB PDB site
Description: Structure of a longer thermalstable core domain of HIV-1 gp41 containing the enfuvirtide resistance mutation N43D
Class: viral protein
Keywords: HIV-1 ENVELOPE GLYCOPROTEIN, 6-helix bundle, gp41, N43D, AIDS, Apoptosis, Coiled coil, Envelope protein, Fusion protein, Host-virus interaction, Membrane, Transmembrane, Virion, VIRAL PROTEIN
Deposited on 2008-03-30, released 2008-06-17
The last revision prior to the SCOP 1.75 freeze date was dated 2008-06-17, with a file datestamp of 2008-06-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.249
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Transmembrane Protein
  Species: Human immunodeficiency virus 1
  Gene: ENV
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q70626
    • engineered (18)
  • Uniprot Q70626
  Domains in SCOP 1.75: d3cp1a1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3cp1A (A:)
  tltvqarqllsgivqqqndllraieaqqhllqltvwgikqlqarsggrggwmewdreinn
  ytslihslieesqnqqekneqellel
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3cp1A (A:)
  tvqarqllsgivqqqndllraieaqqhllqltvwgikqlmewdreinnytslihsliees
  qnqqekneqelle