PDB entry 3cp1

View 3cp1 on RCSB PDB site
Description: Structure of a longer thermalstable core domain of HIV-1 gp41 containing the enfuvirtide resistance mutation N43D
Class: viral protein
Keywords: HIV-1 ENVELOPE GLYCOPROTEIN, 6-helix bundle, gp41, N43D, AIDS, Apoptosis, Coiled coil, Envelope protein, Fusion protein, Host-virus interaction, Membrane, Transmembrane, Virion, VIRAL PROTEIN
Deposited on 2008-03-30, released 2008-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transmembrane Protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3cp1a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cp1A (A:)
    tltvqarqllsgivqqqndllraieaqqhllqltvwgikqlqarsggrggwmewdreinn
    ytslihslieesqnqqekneqellel
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cp1A (A:)
    tvqarqllsgivqqqndllraieaqqhllqltvwgikqlmewdreinnytslihsliees
    qnqqekneqelle