PDB entry 3coq
View 3coq on RCSB PDB site
Description: Structural Basis for Dimerization in DNA Recognition by Gal4
Class: Transcription/DNA
Keywords: helix bundle, Protein-DNA complex, zinc binuclear cluster, Activator, Carbohydrate metabolism, DNA-binding, Galactose metabolism, Metal-binding, Nucleus, Phosphoprotein, Transcription, Transcription regulation, Transcription-DNA COMPLEX
Deposited on
2008-03-29, released
2008-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated
2019-07-24, with a file datestamp of
2019-07-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.21
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: regulatory protein gal4
Species: Saccharomyces cerevisiae [TaxId:4932]
Gene: GAL4
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3coqa1, d3coqa2 - Chain 'B':
Compound: regulatory protein gal4
Species: Saccharomyces cerevisiae [TaxId:4932]
Gene: GAL4
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3coqb1, d3coqb2 - Chain 'D':
Compound: DNA (5'-d(*dap*dcp*dcp*dgp*dgp*dap*dgp*dgp*dap*dcp*dap*dgp*dtp*dcp*dcp*dtp*dcp*dcp*dgp*dg)-3')
Species: synthetic construct, synthetic [TaxId:32630]
- Chain 'E':
Compound: DNA (5'-d(*dtp*dcp*dcp*dgp*dgp*dap*dgp*dgp*dap*dcp*dtp*dgp*dtp*dcp*dcp*dtp*dcp*dcp*dgp*dg)-3')
Species: synthetic construct, synthetic [TaxId:32630]
- Heterogens: MPD, ZN, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3coqA (A:)
eqacdicrlkklkcskekpkcakclknnwecryspktkrspltrahltevesrlerleql
fllifpredldmilkmdslqdikalltgl
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3coqB (B:)
eqacdicrlkklkcskekpkcakclknnwecryspktkrspltrahltevesrlerleql
fllifpredldmilkmdslqdikalltgl
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.