PDB entry 3coq

View 3coq on RCSB PDB site
Description: Structural Basis for Dimerization in DNA Recognition by Gal4
Class: Transcription/DNA
Keywords: helix bundle, Protein-DNA complex, zinc binuclear cluster, Activator, Carbohydrate metabolism, DNA-binding, Galactose metabolism, Metal-binding, Nucleus, Phosphoprotein, Transcription, Transcription regulation, Transcription-DNA COMPLEX
Deposited on 2008-03-29, released 2008-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: regulatory protein gal4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GAL4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3coqa1, d3coqa2
  • Chain 'B':
    Compound: regulatory protein gal4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GAL4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3coqb1, d3coqb2
  • Chain 'D':
    Compound: DNA (5'-d(*dap*dcp*dcp*dgp*dgp*dap*dgp*dgp*dap*dcp*dap*dgp*dtp*dcp*dcp*dtp*dcp*dcp*dgp*dg)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'E':
    Compound: DNA (5'-d(*dtp*dcp*dcp*dgp*dgp*dap*dgp*dgp*dap*dcp*dtp*dgp*dtp*dcp*dcp*dtp*dcp*dcp*dgp*dg)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: MPD, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3coqA (A:)
eqacdicrlkklkcskekpkcakclknnwecryspktkrspltrahltevesrlerleql
fllifpredldmilkmdslqdikalltgl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3coqB (B:)
eqacdicrlkklkcskekpkcakclknnwecryspktkrspltrahltevesrlerleql
fllifpredldmilkmdslqdikalltgl

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.