PDB entry 3coi

View 3coi on RCSB PDB site
Description: Crystal structure of p38delta kinase
Class: transferase
Keywords: Kinase, p38d, p38delta, ERK, MAP kinase, p38-2, PMK, STK26, stress-activated protein kinase, structural genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, ATP-binding, Cell cycle, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase
Deposited on 2008-03-28, released 2008-04-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.208
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 13
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK13, PRKM13, SAPK4
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15264 (2-End)
      • expression tag (0-1)
      • variant (120-121)
    Domains in SCOPe 2.04: d3coia_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3coiA (A:)
    slslirkkgfykqdvnktawelpktyvspthvgsgaygsvcsaidkrsgekvaikklsrp
    fqseifakrayrellllkhmqhenviglldvftpasslrnfydfylvmpfmqtdlqkimg
    lkfseekiqylvyqmlkglkyihsagvvhrdlkpgnlavnedcelkildfglarhadaem
    tgyvvtrwyrapevilswmhynqtvdiwsvgcimaemltgktlfkgkdyldqltqilkvt
    gvpgtefvqklndkaaksyiqslpqtprkdftqlfpraspqaadllekmleldvdkrlta
    aqalthpffepfrdpeeeteaqqpfddslehekltvdewkqhiykeivnfspi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3coiA (A:)
    slslirkkgfykqdvnktawelpktyvspthvgsgaygsvcsaidkrsgekvaikklsrp
    fqseifakrayrellllkhmqhenviglldvftpasslrnfydfylvmpfmqtdlqkimg
    lkfseekiqylvyqmlkglkyihsagvvhrdlkpgnlavnedcelkildfglarhvvtrw
    yrapevilswmhynqtvdiwsvgcimaemltgktlfkgkdyldqltqilkvtgvpgtefv
    qklndkaaksyiqslpqtprkdftqlfpraspqaadllekmleldvdkrltaaqalthpf
    fepfrdpeeeteaqqpfddslehekltvdewkqhiykeivnfsp