PDB entry 3cog

View 3cog on RCSB PDB site
Description: Crystal structure of human cystathionase (Cystathionine gamma lyase) in complex with DL-propargylglycine
Class: lyase
Keywords: CTH, PLP, Propargylglycine, SGC, inhibitor, Structural Genomics, SGC Stockholm, Structural Genomics Consortium, Amino-acid biosynthesis, Cysteine biosynthesis, Disease mutation, Lyase, Phosphoprotein, Pyridoxal phosphate
Deposited on 2008-03-28, released 2008-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.161
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cystathionine gamma-lyase
    Species: HOMO SAPIENS
    Gene: CTH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3coga_
  • Chain 'B':
    Compound: Cystathionine gamma-lyase
    Species: HOMO SAPIENS
    Gene: CTH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cogb_
  • Chain 'C':
    Compound: Cystathionine gamma-lyase
    Species: HOMO SAPIENS
    Gene: CTH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cogc_
  • Chain 'D':
    Compound: Cystathionine gamma-lyase
    Species: HOMO SAPIENS
    Gene: CTH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cogd_
  • Heterogens: NO3, PLP, 2AG, GOL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cogA (A:)
    smqekdassqgflphfqhfatqaihvgqdpeqwtsravvppislsttfkqgapgqhsgfe
    ysrsgnptrnclekavaaldgakyclafasglaatvtithllkagdqiicmddvyggtnr
    yfrqvasefglkisfvdcskiklleaaitpetklvwietptnptqkvidiegcahivhkh
    gdiilvvdntfmspyfqrplalgadismysatkymnghsdvvmglvsvnceslhnrlrfl
    qnslgavpspidcylcnrglktlhvrmekhfkngmavaqflesnpwvekviypglpshpq
    helvkrqctgctgmvtfyikgtlqhaeiflknlklftlaeslggfeslaelpaimthasv
    lkndrdvlgisdtlirlsvgledeedlledldqalkaahppsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cogA (A:)
    gflphfqhfatqaihvgqdpeqwtsravvppislsttfkqgnptrnclekavaaldgaky
    clafasglaatvtithllkagdqiicmddvyggtnryfrqvasefglkisfvdcskikll
    eaaitpetklvwietptnptqkvidiegcahivhkhgdiilvvdntfmspyfqrplalga
    dismysatkymnghsdvvmglvsvnceslhnrlrflqnslgavpspidcylcnrglktlh
    vrmekhfkngmavaqflesnpwvekviypglpshpqhelvkrqctgctgmvtfyikgtlq
    haeiflknlklftlaeslggfeslaelpaimthasvlkndrdvlgisdtlirlsvglede
    edlledldqalkaahp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cogB (B:)
    smqekdassqgflphfqhfatqaihvgqdpeqwtsravvppislsttfkqgapgqhsgfe
    ysrsgnptrnclekavaaldgakyclafasglaatvtithllkagdqiicmddvyggtnr
    yfrqvasefglkisfvdcskiklleaaitpetklvwietptnptqkvidiegcahivhkh
    gdiilvvdntfmspyfqrplalgadismysatkymnghsdvvmglvsvnceslhnrlrfl
    qnslgavpspidcylcnrglktlhvrmekhfkngmavaqflesnpwvekviypglpshpq
    helvkrqctgctgmvtfyikgtlqhaeiflknlklftlaeslggfeslaelpaimthasv
    lkndrdvlgisdtlirlsvgledeedlledldqalkaahppsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cogB (B:)
    gflphfqhfatqaihvgqdpeqwtsravvppislsttfkqgapgqhsgfeysrsgnptrn
    clekavaaldgakyclafasglaatvtithllkagdqiicmddvyggtnryfrqvasefg
    lkisfvdcskiklleaaitpetklvwietptnptqkvidiegcahivhkhgdiilvvdnt
    fmspyfqrplalgadismysatkymnghsdvvmglvsvnceslhnrlrflqnslgavpsp
    idcylcnrglktlhvrmekhfkngmavaqflesnpwvekviypglpshpqhelvkrqctg
    ctgmvtfyikgtlqhaeiflknlklftlaeslggfeslaelpsdtlirlsvgledeedll
    edldqalkaahpp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3cogC (C:)
    smqekdassqgflphfqhfatqaihvgqdpeqwtsravvppislsttfkqgapgqhsgfe
    ysrsgnptrnclekavaaldgakyclafasglaatvtithllkagdqiicmddvyggtnr
    yfrqvasefglkisfvdcskiklleaaitpetklvwietptnptqkvidiegcahivhkh
    gdiilvvdntfmspyfqrplalgadismysatkymnghsdvvmglvsvnceslhnrlrfl
    qnslgavpspidcylcnrglktlhvrmekhfkngmavaqflesnpwvekviypglpshpq
    helvkrqctgctgmvtfyikgtlqhaeiflknlklftlaeslggfeslaelpaimthasv
    lkndrdvlgisdtlirlsvgledeedlledldqalkaahppsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cogC (C:)
    gflphfqhfatqaihvgqdpeqwtsravvppislsttfkqgapgqgfeysrsgnptrncl
    ekavaaldgakyclafasglaatvtithllkagdqiicmddvyggtnryfrqvasefglk
    isfvdcskiklleaaitpetklvwietptnptqkvidiegcahivhkhgdiilvvdntfm
    spyfqrplalgadismysatkymnghsdvvmglvsvnceslhnrlrflqnslgavpspid
    cylcnrglktlhvrmekhfkngmavaqflesnpwvekviypglpshpqhelvkrqctgct
    gmvtfyikgtlqhaeiflknlklftlaeslggfeslaelpaimthasvlkndrdvlgisd
    tlirlsvgledeedlledldqalkaahpps
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3cogD (D:)
    smqekdassqgflphfqhfatqaihvgqdpeqwtsravvppislsttfkqgapgqhsgfe
    ysrsgnptrnclekavaaldgakyclafasglaatvtithllkagdqiicmddvyggtnr
    yfrqvasefglkisfvdcskiklleaaitpetklvwietptnptqkvidiegcahivhkh
    gdiilvvdntfmspyfqrplalgadismysatkymnghsdvvmglvsvnceslhnrlrfl
    qnslgavpspidcylcnrglktlhvrmekhfkngmavaqflesnpwvekviypglpshpq
    helvkrqctgctgmvtfyikgtlqhaeiflknlklftlaeslggfeslaelpaimthasv
    lkndrdvlgisdtlirlsvgledeedlledldqalkaahppsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cogD (D:)
    gflphfqhfatqaihvgqdpeqwtsravvppislsttfkqgapgqhsgfeysrsgnptrn
    clekavaaldgakyclafasglaatvtithllkagdqiicmddvyggtnryfrqvasefg
    lkisfvdcskiklleaaitpetklvwietptnptqkvidiegcahivhkhgdiilvvdnt
    fmspyfqrplalgadismysatkymnghsdvvmglvsvnceslhnrlrflqnslgavpsp
    idcylcnrglktlhvrmekhfkngmavaqflesnpwvekviypglpshpqhelvkrqctg
    ctgmvtfyikgtlqhaeiflknlklftlaeslggfeslaelpaimthasvlkndrdvlgi
    sdtlirlsvgledeedlledldqalkaahpps