PDB entry 3cob

View 3cob on RCSB PDB site
Description: Structural Dynamics of the Microtubule binding and regulatory elements in the Kinesin-like Calmodulin binding protein
Class: motor protein
Keywords: kinesin, motor, switch II, loop L11, conformation, nucleotide, ATP-binding, Microtubule, Motor protein, Nucleotide-binding
Deposited on 2008-03-27, released 2008-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.228
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin heavy chain-like protein
    Species: Solanum tuberosum
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3coba_
  • Chain 'C':
    Compound: Kinesin heavy chain-like protein
    Species: Solanum tuberosum
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cobc_
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cobA (A:)
    edmkgkirvycrlrplcekeiiakernairsvdeftvehlwkddkakqhmydrvfdgnat
    qddvfedtkylvqsavdgynvcifaygqtgsgktftiygadsnpgltpramselfrimkk
    dsnkfsfslkaymvelyqdtlvdlllpkqakrlkldikkdskgmvsvenvtvvsistyee
    lktiiqrgseqrhttgtlmneqssrshlivsviiestnlqtqaiargklsfvdlagserv
    kksgsagnqlkeaqsinkslsalgdvisalssgnqhipyrnhkltmlmsdslggnaktlm
    fvnispaesnldethnsltyasrvrsivndpsknvsskevarlkklvsywkeqagrkgdd
    eeleeiqde
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cobA (A:)
    kgkirvycrlrplcekeiiakernairsvdeftvehlwkddkakqhmydrvfdgnatqdd
    vfedtkylvqsavdgynvcifaygqtgsgktftiygadsnpgltpramselfrimkkdsn
    kfsfslkaymvelyqdtlvdlllpkqakrlkldikkdskgmvsvenvtvvsistyeelkt
    iiqrgseqrhttgtlmneqssrshlivsviiestnlqtqaiargklsfvdlagservkks
    gsagnqlkeaqsinkslsalgdvisalssgnqhipyrnhkltmlmsdslggnaktlmfvn
    ispaesnldethnsltyasrvrsivndpsknvsskevarlkklvsyweleeiqde
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3cobC (C:)
    edmkgkirvycrlrplcekeiiakernairsvdeftvehlwkddkakqhmydrvfdgnat
    qddvfedtkylvqsavdgynvcifaygqtgsgktftiygadsnpgltpramselfrimkk
    dsnkfsfslkaymvelyqdtlvdlllpkqakrlkldikkdskgmvsvenvtvvsistyee
    lktiiqrgseqrhttgtlmneqssrshlivsviiestnlqtqaiargklsfvdlagserv
    kksgsagnqlkeaqsinkslsalgdvisalssgnqhipyrnhkltmlmsdslggnaktlm
    fvnispaesnldethnsltyasrvrsivndpsknvsskevarlkklvsywkeqagrkgdd
    eeleeiqde
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cobC (C:)
    kgkirvycrlrplcekeiiakernairsvdeftvehlwkddkakqhmydrvfdgnatqdd
    vfedtkylvqsavdgynvcifaygqtgsgktftiygadsnpgltpramselfrimkkdsn
    kfsfslkaymvelyqdtlvdlllpkqakrlkldikkdskgmvsvenvtvvsistyeelkt
    iiqrgseqrhttgtlmneqssrshlivsviiestnlqtqaiargklsfvdlagservsin
    kslsalgdvisalssgnqhipyrnhkltmlmsdslggnaktlmfvnispaesnldethns
    ltyasrvrsivndpsknvsskevarlkklvseeleeiqde