PDB entry 3cnz

View 3cnz on RCSB PDB site
Description: Structural dynamics of the microtubule binding and regulatory elements in the kinesin-like calmodulin binding protein
Class: motor protein
Keywords: kinesin, loop L11, switch II, motor, ATP-binding, Microtubule, Motor protein, Nucleotide-binding
Deposited on 2008-03-26, released 2008-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.271
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin heavy chain-like protein
    Species: Solanum tuberosum
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cnza_
  • Chain 'B':
    Compound: Kinesin heavy chain-like protein
    Species: Solanum tuberosum
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cnzb_
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cnzA (A:)
    edmkgkirvycrlrplcekeiiakernairsvdeftvehlwkddkakqhmydrvfdgnat
    qddvfedtkylvqsavdgynvcifaygqtgsgktftiygadsnpgltpramselfrimkk
    dsnkfsfslkaymvelyqdtlvdlllpkqakrlkldikkdskgmvsvenvtvvsistyee
    lktiiqrgseqrhttgtlmneqssrshlivsviiestnlqtqaiargklsfvdlagserv
    kksgsagnqlkeaqsinkslsalgdvisalssgnqhipyrnhkltmlmsdslggnaktlm
    fvnispaesnldethnsltyasrvrsivndpsknvsskevarlkklvsywkeqagrkgdd
    eeleeiqde
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cnzA (A:)
    kirvycrlrplcekeiiakernairsvdeftvehlwkkakqhmydrvfdgnatqddvfed
    tkylvqsavdgynvcifaygqtgsgktftiygadsnpgltpramselfrimkkdsnkfsf
    slkaymvelyqdtlvdlllpkqakrlkldikkdskgmvsvenvtvvsistyeelktiiqr
    gseqrhttqssrshlivsviiestnlqtqaiargklsfvdlagsenkslsalgdvisals
    sgnqhipyrnhkltmlmsdslggnaktlmfvnispaesnldethnsltyasrvrsivndp
    sknvsskevarlkklvsywkeqagrkleeiqde
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cnzB (B:)
    edmkgkirvycrlrplcekeiiakernairsvdeftvehlwkddkakqhmydrvfdgnat
    qddvfedtkylvqsavdgynvcifaygqtgsgktftiygadsnpgltpramselfrimkk
    dsnkfsfslkaymvelyqdtlvdlllpkqakrlkldikkdskgmvsvenvtvvsistyee
    lktiiqrgseqrhttgtlmneqssrshlivsviiestnlqtqaiargklsfvdlagserv
    kksgsagnqlkeaqsinkslsalgdvisalssgnqhipyrnhkltmlmsdslggnaktlm
    fvnispaesnldethnsltyasrvrsivndpsknvsskevarlkklvsywkeqagrkgdd
    eeleeiqde
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cnzB (B:)
    kirvycrlrplcekeiiakernavdeftvehlwkkqhmydrvfdgnatqddvfedtkylv
    qsavdgynvcifaygqtgsgktftiygadsnpgltpramselfrimkkdsnkfsfslkay
    mvelyqdtlvdlllpkqakrlkldikkdskgmvsvenvtvvsistyeelktiiqrgseqr
    htlmneqssrshlivsviiestnlqtqaiargklsfvdlagservnkslsalgdvisals
    sgnqhipyrnhkltmlmsdslggnaktlmfvnispaesnldethnsltyasrvrsivndp
    sknvsskevarlkklvsywkeqaeleeiqde