PDB entry 3cnw

View 3cnw on RCSB PDB site
Description: Three-dimensional structure of the protein XoxI (Q81AY6) from Bacillus cereus. Northeast Structural Genomics Consortium target BcR196.
Class: structural genomics, unknown function
Keywords: Q81AY6, NESG, X-RAY, XoxI, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2008-03-26, released 2008-04-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.206
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein XoxI
    Species: Bacillus cereus ATCC 14579 [TaxId:226900]
    Gene: BC_3411
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81AY6 (Start-139)
      • expression tag (140-143)
    Domains in SCOPe 2.05: d3cnwa1
  • Chain 'B':
    Compound: Protein XoxI
    Species: Bacillus cereus ATCC 14579 [TaxId:226900]
    Gene: BC_3411
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81AY6 (0-139)
      • expression tag (140)
    Domains in SCOPe 2.05: d3cnwb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cnwA (A:)
    mnmahtttsmeifgspeqvwqliggfnslpdwlpyipssklteggrvrhlanpdgdtiie
    rlevfndkeryytysimnapfpvtnylstiqvkegtesntslvewsgtftpvevsdeeai
    nlfhgiysdglkalqqafldlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cnwA (A:)
    mahtttsmeifgspeqvwqliggfnslpdwlpyipssklteggrvrhlanpdgdtiierl
    evfndkeryytysimnapfpvtnylstiqvkegtesntslvewsgtftpvevsdeeainl
    fhgiysdglkalqqafldlehh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cnwB (B:)
    mnmahtttsmeifgspeqvwqliggfnslpdwlpyipssklteggrvrhlanpdgdtiie
    rlevfndkeryytysimnapfpvtnylstiqvkegtesntslvewsgtftpvevsdeeai
    nlfhgiysdglkalqqafldlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cnwB (B:)
    mnmahtttsmeifgspeqvwqliggfnslpdwlpyipssklteggrvrhlanpdgdtiie
    rlevfndkeryytysimnapfpvtnylstiqvkegtesntslvewsgtftpvevsdeeai
    nlfhgiysdglkalqqafldl