PDB entry 3cnq

View 3cnq on RCSB PDB site
Description: Prosubtilisin Substrate Complex of Subtilisin SUBT_BACAM
Class: hydrolase
Keywords: uncleaved, proenzyme, substrate complex, Hydrolase, Metal-binding, Protease, Secreted, Serine protease, Sporulation, Zymogen
Deposited on 2008-03-26, released 2008-05-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-04-21, with a file datestamp of 2010-04-16.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.193
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: subtilisin bpn'
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Gene: APR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00782 (Start-74)
      • engineered (25)
      • engineered (35)
      • engineered (38)
      • engineered (55)
      • engineered (70-73)
      • engineered (75)
      • expression tag (76-77)
    Domains in SCOPe 2.01: d3cnqp_
  • Chain 'S':
    Compound: subtilisin bpn'
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Gene: APR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00782 (Start-265)
      • engineered (2)
      • engineered (4)
      • engineered (8)
      • engineered (30-31)
      • engineered (42)
      • engineered (49)
      • engineered (73)
      • engineered (94)
      • engineered (118)
      • engineered (146)
      • engineered (156)
      • engineered (159)
      • engineered (178)
      • engineered (196)
      • engineered (202)
      • engineered (207-208)
      • engineered (211)
      • engineered (244)
      • engineered (261)
    Domains in SCOPe 2.01: d3cnqs_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3cnqP (P:)
    mggksngekkyivgfkqgfkscakkedvisekggklqkcfkyvdaasatlnekaveelkk
    dpsvayveedklyralsats
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cnqP (P:)
    ekkyivgfkqgfkscakkedvisekggklqkcfkyvdaasatlnekaveelkkdpsvayv
    eedklyralsa
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3cnqS (S:)
    akcvsygvaqikapalhsqgytgsnvkvavlasgidsshpdlnvaggasfvpsetnpfqd
    nnshgthvagtvlavapsaslyavkvlgadgsgqaswiingiewaiannmdvinmslgsp
    sgsaalkaavdkavasgvvvvaaagnsgtsgssstvsypakypsviavgavdssnqrapf
    ssvgpeldvmapgvsicstlpggkygalsgtamasphvagaaalilskhpnwtntqvrss
    lentatklgdsfyygkglinveaaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cnqS (S:)
    cvsygvaqikapalhsqgytgsnvkvavlasgidsshpdlnvaggasfvpsetnpfqdnn
    shgthvagtvlavapsaslyavkvlgadgsgqaswiingiewaiannmdvinmslgspsg
    saalkaavdkavasgvvvvaaagnsgtsgssstvsypakypsviavgavdssnqrapfss
    vgpeldvmapgvsicstlpggkygalsgtamasphvagaaalilskhpnwtntqvrssle
    ntatklgdsfyygkglinveaaaq