PDB entry 3cnk

View 3cnk on RCSB PDB site
Description: Crystal Structure of the dimerization domain of human filamin A
Class: structural protein
Keywords: Filamin, FLNa24, X-ray crystalography, homodimer, Acetylation, Actin-binding, Cytoplasm, Cytoskeleton, Disease mutation, Phosphoprotein, Polymorphism, STRUCTURAL PROTEIN
Deposited on 2008-03-26, released 2009-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Filamin-A
    Species: Homo sapiens [TaxId:9606]
    Gene: FLNA, FLN, FLN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cnka_
  • Chain 'B':
    Compound: Filamin-A
    Species: Homo sapiens [TaxId:9606]
    Gene: FLNA, FLN, FLN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cnkb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cnkA (A:)
    kvvakglglskayvgqkssftvdcskagnnmllvgvhgprtpceeilvkhvgsrlysvsy
    llkdkgeytlvvkwghehipgspyrvvvp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cnkB (B:)
    kvvakglglskayvgqkssftvdcskagnnmllvgvhgprtpceeilvkhvgsrlysvsy
    llkdkgeytlvvkwghehipgspyrvvvp