PDB entry 3cmr

View 3cmr on RCSB PDB site
Description: E. coli alkaline phosphatase mutant R166S in complex with phosphate
Class: hydrolase
Keywords: alkaline phosphatase, phosphoryl transfer, arginine, phosphate, Hydrolase, Magnesium, Metal-binding, Phosphoprotein
Deposited on 2008-03-24, released 2008-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.182
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alkaline phosphatase
    Species: ESCHERICHIA COLI
    Gene: PHOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634
      • engineered (165)
    Domains in SCOPe 2.07: d3cmra_
  • Chain 'B':
    Compound: alkaline phosphatase
    Species: ESCHERICHIA COLI
    Gene: PHOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634
      • engineered (165)
    Domains in SCOPe 2.07: d3cmrb_
  • Heterogens: ZN, PO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cmrA (A:)
    tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsskcygpsatsekcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
    aygphaanvvgltdqtdlfytmkaalglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cmrA (A:)
    mpvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaarn
    yaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvd
    ihekdhptilemakaaglatgnvstaelqdatpaalvahvtsskcygpsatsekcpgnal
    ekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaasl
    nsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmt
    dkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkegntl
    vivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaayg
    phaanvvgltdqtdlfytmkaalgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cmrB (B:)
    tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsskcygpsatsekcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
    aygphaanvvgltdqtdlfytmkaalglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cmrB (B:)
    mpvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaarn
    yaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvd
    ihekdhptilemakaaglatgnvstaelqdatpaalvahvtsskcygpsatsekcpgnal
    ekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaasl
    nsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmt
    dkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkegntl
    vivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaayg
    phaanvvgltdqtdlfytmkaalgl