PDB entry 3cmo

View 3cmo on RCSB PDB site
Description: HIV neutralizing monoclonal antibody YZ18
Class: Immune System
Keywords: HIV-1, monoclonal antibody, Immune System
Deposited on 2008-03-24, released 2008-08-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.248
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab heavy chain
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • PDB 3CMO (0-221)
    Domains in SCOPe 2.06: d3cmoh1
  • Chain 'L':
    Compound: Fab light chain
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • PDB 3CMO (0-209)
    Domains in SCOPe 2.06: d3cmol1, d3cmol2
  • Chain 'X':
    Compound: Fab light chain
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • PDB 3CMO (Start-209)
    Domains in SCOPe 2.06: d3cmox1, d3cmox2
  • Chain 'Y':
    Compound: Fab heavy chain
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • PDB 3CMO (0-221)
    Domains in SCOPe 2.06: d3cmoy1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cmoH (H:)
    avqlsqsgtvlarpgasvkmsckasgytftsywmhwvkqrpgqglewigaiypgnsdtsy
    nqkfkgkakltavtsastaymelssltnedsavyyctrwphyyggsryyfdywgqgttlt
    vssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavl
    qsdlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cmoL (L:)
    divmtqsssslsaslgdrvtiscrasqdisnylnwyqqkpdgtvelliyytsrlqsgvps
    rfsgsgsgsdysltisnlvpediatyycqqysklftfgsgtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnr
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3cmoX (X:)
    divmtqsssslsaslgdrvtiscrasqdisnylnwyqqkpdgtvelliyytsrlqsgvps
    rfsgsgsgsdysltisnlvpediatyycqqysklftfgsgtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cmoX (X:)
    ivmtqsssslsaslgdrvtiscrasqdisnylnwyqqkpdgtvelliyytsrlqsgvpsr
    fsgsgsgsdysltisnlvpediatyycqqysklftfgsgtkleikradaaptvsifppss
    eqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltlt
    kdeyerhnsytceathktstspivksfnr
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cmoY (Y:)
    avqlsqsgtvlarpgasvkmsckasgytftsywmhwvkqrpgqglewigaiypgnsdtsy
    nqkfkgkakltavtsastaymelssltnedsavyyctrwphyyggsryyfdywgqgttlt
    vssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavl
    qsdlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep