PDB entry 3cmm

View 3cmm on RCSB PDB site
Description: Crystal Structure of the Uba1-Ubiquitin Complex
Class: ligase/protein binding
Keywords: Ubiquitin, E1, Uba1, Protein turnover, ligase, Conformational change, thioester, adenylation, transthioesterification, ATP-binding, Nucleotide-binding, Nucleus, Phosphoprotein, Ubl conjugation pathway, DNA damage, DNA repair, LIGASE-PROTEIN BINDING COMPLEX
Deposited on 2008-03-23, released 2008-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-activating enzyme E1 1
    Species: SACCHAROMYCES CEREVISIAE
    Gene: UBA1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ubiquitin
    Species: SACCHAROMYCES CEREVISIAE
    Gene: UBI1, RPL40A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cmmb_
  • Chain 'C':
    Compound: Ubiquitin-activating enzyme E1 1
    Species: SACCHAROMYCES CEREVISIAE
    Gene: UBA1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ubiquitin
    Species: SACCHAROMYCES CEREVISIAE
    Gene: UBI1, RPL40A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cmmd_
  • Heterogens: PRO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cmmB (B:)
    mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cmmD (D:)
    mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg