PDB entry 3cmj

View 3cmj on RCSB PDB site
Description: Crystal Structure of engineered Beta-Glucosidase from Soil metagenome
Class: hydrolase
Keywords: Bgl, HYDROLASE
Deposited on 2008-03-22, released 2008-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.165
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0GMU3
      • engineered (23-24)
      • engineered (27)
      • engineered (459)
      • engineered (463)
    Domains in SCOPe 2.07: d3cmja_
  • Heterogens: NA, SRT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cmjA (A:)
    mgsshhhhhhssglvprgshmnvkkfpegflwgaatssyqiegawnedgkgesiwdrftr
    ipgkikngdsgdvacdhyhryeqdldlmrqlglktyrfsiawariqpdssrqinqrgldf
    yrrlveglhkrdilpmatlyhwdlpqwvedeggwlsresasrfaeythalvaalgdqipl
    wvthnepmvtvwagyhmglfapglkdptlggrvahhlllshgqalqafralspagsqmgi
    tlnfntiypvsaepadveaarrmhsfqnelfleplirgqynqatlmaypnlpefiapedm
    qtisapidflgvnyynpmrvksspqppgievvqvespvtamgweiapeglydllmgitrt
    ygklpiyitengaafddqpdqsgqvndpqrvgyfqghigaarraladgvdlrgyyawsll
    dnfewaegyskrfgiiyvdfetqqrtlkqsaqwyrdvianngled
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cmjA (A:)
    kkfpegflwgaatssyqiegawnedgkgesiwdrftripgkikngdsgdvacdhyhryeq
    dldlmrqlglktyrfsiawariqpdssrqinqrgldfyrrlveglhkrdilpmatlyhwd
    lpqwvedeggwlsresasrfaeythalvaalgdqiplwvthnepmvtvwagyhmglfapg
    lkdptlggrvahhlllshgqalqafralspagsqmgitlnfntiypvsaepadveaarrm
    hsfqnelfleplirgqynqatlmaypnlpefiapedmqtisapidflgvnyynpmrvkss
    pqppgievvqvespvtamgweiapeglydllmgitrtygklpiyitengaafddqpdqsg
    qvndpqrvgyfqghigaarraladgvdlrgyyawslldnfewaegyskrfgiiyvdfetq
    qrtlkqsaqwyrdvianngle