PDB entry 3cmc

View 3cmc on RCSB PDB site
Description: Thioacylenzyme intermediate of Bacillus stearothermophilus phosphorylating GAPDH
Class: oxidoreductase
Keywords: microspectrophotometry, reaction intermediate, dehydrogenase, phosphate binding site, thioacylenzyme, Glycolysis, NAD, Oxidoreductase
Deposited on 2008-03-21, released 2008-06-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.163
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Bacillus stearothermophilus
    Gene: GAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3cmco1, d3cmco2
  • Chain 'P':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Bacillus stearothermophilus
    Gene: GAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3cmcp1, d3cmcp2
  • Chain 'Q':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Bacillus stearothermophilus
    Gene: GAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3cmcq1, d3cmcq2
  • Chain 'R':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Bacillus stearothermophilus
    Gene: GAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3cmcr1, d3cmcr2
  • Heterogens: SO4, G3H, NAD, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cmcO (O:)
    avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnascttnclapfakvlheqfgivrgmmttvhsy
    tndqrildlphkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cmcP (P:)
    avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnascttnclapfakvlheqfgivrgmmttvhsy
    tndqrildlphkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cmcQ (Q:)
    avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnascttnclapfakvlheqfgivrgmmttvhsy
    tndqrildlphkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cmcR (R:)
    avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnascttnclapfakvlheqfgivrgmmttvhsy
    tndqrildlphkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl