PDB entry 3cm4

View 3cm4 on RCSB PDB site
Description: Crystal structure of metal-free sialic acid synthase (NeuB) from neisseria meningitidis in complex with malate
Class: biosynthetic protein
Keywords: BIOSYNTHETIC PROTEIN, TIM BARREL, ANTIFREEZE-LIKE DOMAIN, DOMAIN-SWAPPED DIMER, Lyase
Deposited on 2008-03-20, released 2008-04-22
Made obsolete by 6ppx on 2019-10-09

The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.199
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Capsule biosynthesis protein
    Species: Neisseria meningitidis [TaxId:487]
    Gene: synC, siaC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3cm4a1, d3cm4a2
  • Heterogens: MLT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cm4A (A:)
    mqnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthive
    demsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaalrl
    qrmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpyall
    hctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhftdr
    mdrpgpdivcsmnpdtfkelkqgahalklarggkkdtiiagekptkdfafasvvadkdik
    kgellsgdnlwvkrpgngdfsvneyetlfgkvaacnirkgaqikktdie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cm4A (A:)
    qnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthived
    emsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaalrlq
    rmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpyallh
    ctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhftdrm
    drpgpdivcsmnpdtfkelkqgahalklarggkkdtiiagekptkdfafasvvadkdikk
    gellsgdnlwvkrpgngdfsvneyetlfgkvaacnirkgaqikktdie