PDB entry 3cly

View 3cly on RCSB PDB site
Description: Crystal Structure of FGF Receptor 2 (FGFR2) Kinase Domains Trapped in Trans-Phosphorylation Reaction
Class: transferase
Keywords: Kinase Domain, Trans-Phosphorylation, ATP-binding, Disease mutation, Ectodermal dysplasia, Glycoprotein, Heparin-binding, Immunoglobulin domain, Lacrimo-auriculo-dento-digital syndrome, Membrane, Nucleotide-binding, Phosphoprotein, Receptor, Secreted, Transferase, Transmembrane, Tyrosine-protein kinase
Deposited on 2008-03-20, released 2009-02-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-03-07, with a file datestamp of 2012-03-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR2, BEK, KGFR, KSAM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802
      • engineered (46)
    Domains in SCOPe 2.04: d3clya_
  • Heterogens: MG, ACP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3clyA (A:)
    mgsshhhhhhsqdpmlagvseyelpedpkwefprdkltlgkplgegafgqvvmaeavgid
    kdkpkeavtvavkmlkddatekdlsdlvsememmkmigkhkniinllgactqdgplyviv
    eyaskgnlreylrarrppgmeysydinrvpeeqmtfkdlvsctyqlargmeylasqkcih
    rdlaarnvlvtennvmkiadfglardinnidyykkttngrlpvkwmapealfdrvythqs
    dvwsfgvlmweiftlggspypgipveelfkllkeghrmdkpanctnelymmmrdcwhavp
    sqrptfkqlvedldriltlttneeyldlsqpleq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3clyA (A:)
    lpedpkwefprdkltlgkplgegafgqvvmaeavgidkdkpkeavtvavkmlkddatekd
    lsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarreeqmtfk
    dlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfglardinnidyykktt
    ngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipveelfkllkeghr
    mdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlttneeyldl