PDB entry 3clp

View 3clp on RCSB PDB site
Description: M. loti cyclic-nucleotide binding domain mutant 2
Class: membrane protein
Keywords: Mlotik1 cyclic-nucleotide binding domain mutant 2. Cyclic-AMP bound, MEMBRANE PROTEIN
Deposited on 2008-03-19, released 2008-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mll3241 protein
    Species: Rhizobium loti
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q98GN8
      • engineered (91)
    Domains in SCOPe 2.07: d3clpa_
  • Chain 'C':
    Compound: Mll3241 protein
    Species: Rhizobium loti
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q98GN8
      • engineered (91)
    Domains in SCOPe 2.07: d3clpc_
  • Heterogens: CMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3clpA (A:)
    qevrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffv
    vegsvsvatpnpvelgpgaffgemalisgepesatvsaattvsllslhsadfqmlcsssp
    eiaeifrktalerrgaaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3clpA (A:)
    vrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvve
    gsvsvatpnpvelgpgaffgemalisgepesatvsaattvsllslhsadfqmlcssspei
    aeifrktalerr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3clpC (C:)
    qevrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffv
    vegsvsvatpnpvelgpgaffgemalisgepesatvsaattvsllslhsadfqmlcsssp
    eiaeifrktalerrgaaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3clpC (C:)
    vrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvve
    gsvsvatpnpvelgpgaffgemalisgepesatvsaattvsllslhsadfqmlcssspei
    aeifrktalerrg