PDB entry 3cln

View 3cln on RCSB PDB site
Description: structure of calmodulin refined at 2.2 angstroms resolution
Deposited on 1988-05-11, released 1988-07-16
The last revision prior to the SCOP 1.57 freeze date was dated 1989-01-09, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.175
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d3cln__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cln_ (-)
    teeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngtid
    fpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdem
    ireanidgdgqvnyeefvqmmta