PDB entry 3cl7

View 3cl7 on RCSB PDB site
Description: Crystal structure of Puue Allantoinase in complex with Hydantoin
Class: hydrolase
Keywords: Allantoinase, uric acid degradation, hydantoin, HYDROLASE
Deposited on 2008-03-18, released 2008-06-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.201
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Puue allantoinase
    Species: Pseudomonas fluorescens [TaxId:294]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CL7
    Domains in SCOPe 2.06: d3cl7a_
  • Chain 'B':
    Compound: Puue allantoinase
    Species: Pseudomonas fluorescens [TaxId:294]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CL7
    Domains in SCOPe 2.06: d3cl7b_
  • Heterogens: HYN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cl7A (A:)
    msvdyprdligygsnpphphwpgkarialsfvlnyeeggernilhgdkeseaflsemvsa
    qplqgernmsmeslyeygsragvwrilklfkafdipltifavamaaqrhpdviramvaag
    heicshgyrwidyqymdeaqerehmleairilteltgerplgwytgrtgpntrrlvmeeg
    gflydcdtydddlpywepnnptgkphlvipytldtndmrftqvqgfnkgddffeylkdaf
    dvlyaegaeapkmlsiglhcrligrparlaalqrfieyaksheqvwftrrvdiarhwhat
    hpytgaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cl7A (A:)
    vdyprdligygsnpphphwpgkarialsfvlnyeeggernilhgdkeseaflsemvsaqp
    lqgernmsmeslyeygsragvwrilklfkafdipltifavamaaqrhpdviramvaaghe
    icshgyrwidyqymdeaqerehmleairilteltgerplgwytgrtgpntrrlvmeeggf
    lydcdtydddlpywepnnptgkphlvipytldtndmrftqvqgfnkgddffeylkdafdv
    lyaegaeapkmlsiglhcrligrparlaalqrfieyaksheqvwftrrvdiarhwhathp
    yt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cl7B (B:)
    msvdyprdligygsnpphphwpgkarialsfvlnyeeggernilhgdkeseaflsemvsa
    qplqgernmsmeslyeygsragvwrilklfkafdipltifavamaaqrhpdviramvaag
    heicshgyrwidyqymdeaqerehmleairilteltgerplgwytgrtgpntrrlvmeeg
    gflydcdtydddlpywepnnptgkphlvipytldtndmrftqvqgfnkgddffeylkdaf
    dvlyaegaeapkmlsiglhcrligrparlaalqrfieyaksheqvwftrrvdiarhwhat
    hpytgaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cl7B (B:)
    vdyprdligygsnpphphwpgkarialsfvlnyeeggernilhgdkeseaflsemvsaqp
    lqgernmsmeslyeygsragvwrilklfkafdipltifavamaaqrhpdviramvaaghe
    icshgyrwidyqymdeaqerehmleairilteltgerplgwytgrtgpntrrlvmeeggf
    lydcdtydddlpywepnnptgkphlvipytldtndmrftqvqgfnkgddffeylkdafdv
    lyaegaeapkmlsiglhcrligrparlaalqrfieyaksheqvwftrrvdiarhwhathp
    yt