PDB entry 3cl2

View 3cl2 on RCSB PDB site
Description: N1 Neuraminidase N294S + Oseltamivir
Class: viral protein, hydrolase
Keywords: N1, Neuraminidase, N294S, Oseltamivir, Glycosidase, Hydrolase, Membrane, Transmembrane, Virion, VIRAL PROTEIN
Deposited on 2008-03-18, released 2008-05-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.24
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: INFLUENZA A VIRUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DPL2 (0-384)
      • conflict (170)
      • engineered (212)
    Domains in SCOPe 2.05: d3cl2a_
  • Chain 'B':
    Compound: Neuraminidase
    Species: INFLUENZA A VIRUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DPL2 (0-384)
      • conflict (170)
      • engineered (212)
    Domains in SCOPe 2.05: d3cl2b_
  • Chain 'C':
    Compound: Neuraminidase
    Species: INFLUENZA A VIRUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DPL2 (0-384)
      • conflict (170)
      • engineered (212)
    Domains in SCOPe 2.05: d3cl2c_
  • Chain 'D':
    Compound: Neuraminidase
    Species: INFLUENZA A VIRUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DPL2 (0-384)
      • conflict (170)
      • engineered (212)
    Domains in SCOPe 2.05: d3cl2d_
  • Chain 'E':
    Compound: Neuraminidase
    Species: INFLUENZA A VIRUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DPL2 (0-384)
      • conflict (170)
      • engineered (212)
    Domains in SCOPe 2.05: d3cl2e_
  • Chain 'F':
    Compound: Neuraminidase
    Species: INFLUENZA A VIRUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DPL2 (0-384)
      • conflict (170)
      • engineered (212)
    Domains in SCOPe 2.05: d3cl2f_
  • Chain 'G':
    Compound: Neuraminidase
    Species: INFLUENZA A VIRUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DPL2 (0-384)
      • conflict (170)
      • engineered (212)
    Domains in SCOPe 2.05: d3cl2g_
  • Chain 'H':
    Compound: Neuraminidase
    Species: INFLUENZA A VIRUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DPL2 (0-384)
      • conflict (170)
      • engineered (212)
    Domains in SCOPe 2.05: d3cl2h_
  • Heterogens: G39

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cl2A (A:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdswhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpfti
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cl2B (B:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdswhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpfti
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cl2C (C:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdswhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpfti
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cl2D (D:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdswhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpfti
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cl2E (E:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdswhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpfti
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cl2F (F:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdswhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpfti
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cl2G (G:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdswhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpfti
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cl2H (H:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyhyeecscypnageitcvcrdswhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpfti