PDB entry 3cl0

View 3cl0 on RCSB PDB site
Description: N1 Neuraminidase H274Y + oseltamivir
Class: viral protein, hydrolase
Keywords: N1, neuraminidase, H274Y, oseltamivir, Glycosidase, Hydrolase, Membrane, Transmembrane, Virion, VIRAL PROTEIN
Deposited on 2008-03-18, released 2008-05-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: INFLUENZA A VIRUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DPL2 (0-384)
      • conflict (170)
      • engineered (192)
    Domains in SCOPe 2.05: d3cl0a_
  • Heterogens: G39, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cl0A (A:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyyyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpfti