PDB entry 3ckz

View 3ckz on RCSB PDB site
Description: N1 Neuraminidase H274Y + Zanamivir
Class: viral protein, hydrolase
Keywords: N1, Neuraminidase, H274Y, Zanamivir, Glycosidase, Hydrolase, Membrane, Transmembrane, Virion, VIRAL PROTEIN
Deposited on 2008-03-18, released 2008-05-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.202
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: INFLUENZA A VIRUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DPL2 (0-384)
      • conflict (170)
      • engineered (192)
    Domains in SCOPe 2.05: d3ckza_
  • Heterogens: CA, ZMR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ckzA (A:)
    vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
    khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
    vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
    vvksveldapnyyyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
    gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
    tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
    isfcgvnsdtvgwswpdgaelpfti