PDB entry 3ckl

View 3ckl on RCSB PDB site
Description: Crystal structure of human cytosolic sulfotransferase SULT1B1 in complex with PAP and resveratrol
Class: transferase
Keywords: SULT1B1, human cytosolic sulfotransferase, resveratrol, SGC, Cytoplasm, Lipid metabolism, Polymorphism, Steroid metabolism, Structural Genomics, Structural Genomics Consortium
Deposited on 2008-03-16, released 2008-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sulfotransferase family cytosolic 1B member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SULT1B1, ST1B2, SULT1B2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3ckla_
  • Chain 'B':
    Compound: Sulfotransferase family cytosolic 1B member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SULT1B1, ST1B2, SULT1B2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3cklb_
  • Heterogens: STL, A3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cklA (A:)
    gsmlspkdilrkdlklvhgypmtcafasnwekieqfhsrpddiviatypksgttwvseii
    dmilndgdiekckrgfitekvpmlemtlpglrtsgieqleknpsprivkthlptdllpks
    fwennckmiylarnakdvsvsyyhfdlmnnlqpfpgtweeylekfltgkvaygswfthvk
    nwwkkkeehpilflyyedmkenpkeeikkiirfleknlndeildriihhtsfevmkdnpl
    vnythlpttvmdhskspfmrkgtagdwknyftvaqnekfdaiyetemsktalqfrtei
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cklA (A:)
    dilrkdlklvhgypmtcafasnwekieqfhsrpddiviatypksgttwvseiidmilndg
    diekckrgfitekvpmlemtlgrtsgieqleknpsprivkthlptdllpksfwennckmi
    ylarnakdvsvsyyhfdlmnnlqpfpgtweeylekfltgkvaygswfthvknwwkkkeeh
    pilflyyedmkenpkeeikkiirfleknlndeildriihhtsfevmkdnplvnythlptt
    vmdhskspfmrkgtagdwknyftvaqnekfdaiyetemsktalqfrtei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cklB (B:)
    gsmlspkdilrkdlklvhgypmtcafasnwekieqfhsrpddiviatypksgttwvseii
    dmilndgdiekckrgfitekvpmlemtlpglrtsgieqleknpsprivkthlptdllpks
    fwennckmiylarnakdvsvsyyhfdlmnnlqpfpgtweeylekfltgkvaygswfthvk
    nwwkkkeehpilflyyedmkenpkeeikkiirfleknlndeildriihhtsfevmkdnpl
    vnythlpttvmdhskspfmrkgtagdwknyftvaqnekfdaiyetemsktalqfrtei
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cklB (B:)
    mlspkdilrkdlklvhgypmtcafasnwekieqfhsrpddiviatypksgttwvseiidm
    ilndgdiekckrgfitekvpmlemtlpglrtsgieqleknpsprivkthlptdllpksfw
    ennckmiylarnakdvsvsyyhfdlmnnlqpfpgtweeylekfltgkvaygswfthvknw
    wkkkeehpilflyyedmkenpkeeikkiirfleknlndeildriihhtsfevmkdnplvn
    ythlpttvmdhskspfmrkgtagdwknyftvaqnekfdaiyetemsktalqfrtei