PDB entry 3ck0

View 3ck0 on RCSB PDB site
Description: anti-anti-idiotypic antibody against human angiotensin II, complex with human angiotensin II
Class: immune system
Keywords: immunoglobulin
Deposited on 1999-06-14, released 2003-08-05
The last revision prior to the SCOP 1.73 freeze date was dated 2003-08-05, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.2
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: protein (immunoglobulin; heavy chain)
    Species: MUS MUSCULUS
    Domains in SCOP 1.73: d3ck0h1, d3ck0h2
  • Chain 'L':
    Compound: protein (immunoglobulin; light chain)
    Species: MUS MUSCULUS
    Domains in SCOP 1.73: d3ck0l1, d3ck0l2
  • Chain 'P':
    Compound: protein (8-mer; human angiotensin II)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ck0H (H:)
    qvqlqesggglvqprgslklscaasgftfntdamnwvrqapgkglewvarirskgfnfat
    yyadsvrdrftisrddsqsmlylqmnnlktedtgiyycvrgrdgeamdywgqgttltvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpssprpsetvtcnvahpasstkvdkkivn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ck0H (H:)
    qvqlqesggglvqprgslklscaasgftfntdamnwvrqapgkglewvarirskgfnfat
    yyadsvrdrftisrddsqsmlylqmnnlktedtgiyycvrgrdgeamdywgqgttltvss
    akttppsvyplapmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssv
    tvpssprpsetvtcnvahpasstkvdkkivn
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ck0L (L:)
    diqltqspsslavsagekvtmnckssqnllhsitrknylawyrqkpgqspklliywastr
    gsgvpdrftgsgsgtdftltissvqaedlavyyckqsynlytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'P':
    No sequence available.