PDB entry 3ck0

View 3ck0 on RCSB PDB site
Description: anti-anti-idiotypic antibody against human angiotensin ii, complex with human angiotensin ii
Deposited on 1999-06-14, released 2003-08-05
The last revision prior to the SCOP 1.69 freeze date was dated 2003-08-05, with a file datestamp of 2003-08-05.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.2
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ck0H (H:)
    qvqlqesggglvqprgslklscaasgftfntdamnwvrqapgkglewvarirskgfnfat
    yyadsvrdrftisrddsqsmlylqmnnlktedtgiyycvrgrdgeamdywgqgttltvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpssprpsetvtcnvahpasstkvdkkivn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ck0H (H:)
    qvqlqesggglvqprgslklscaasgftfntdamnwvrqapgkglewvarirskgfnfat
    yyadsvrdrftisrddsqsmlylqmnnlktedtgiyycvrgrdgeamdywgqgttltvss
    akttppsvyplapmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssv
    tvpssprpsetvtcnvahpasstkvdkkivn
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ck0L (L:)
    diqltqspsslavsagekvtmnckssqnllhsitrknylawyrqkpgqspklliywastr
    gsgvpdrftgsgsgtdftltissvqaedlavyyckqsynlytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr