PDB entry 3ck0

View 3ck0 on RCSB PDB site
Description: anti-anti-idiotypic antibody against human angiotensin II, complex with human angiotensin II
Class: immune system
Keywords: immunoglobulin, immune system
Deposited on 1999-06-14, released 2003-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.2
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: protein (immunoglobulin; heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CK0 (0-218)
    Domains in SCOPe 2.07: d3ck0h1, d3ck0h2, d3ck0h3
  • Chain 'L':
    Compound: protein (immunoglobulin; light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CK0 (0-215)
    Domains in SCOPe 2.07: d3ck0l1, d3ck0l2
  • Chain 'P':
    Compound: protein (8-mer; human angiotensin II)
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CK0 (0-7)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ck0H (H:)
    qvqlqesggglvqprgslklscaasgftfntdamnwvrqapgkglewvarirskgfnfat
    yyadsvrdrftisrddsqsmlylqmnnlktedtgiyycvrgrdgeamdywgqgttltvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpssprpsetvtcnvahpasstkvdkkivn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ck0H (H:)
    qvqlqesggglvqprgslklscaasgftfntdamnwvrqapgkglewvarirskgfnfat
    yyadsvrdrftisrddsqsmlylqmnnlktedtgiyycvrgrdgeamdywgqgttltvss
    akttppsvyplapmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssv
    tvpssprpsetvtcnvahpasstkvdkkivn
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ck0L (L:)
    diqltqspsslavsagekvtmnckssqnllhsitrknylawyrqkpgqspklliywastr
    gsgvpdrftgsgsgtdftltissvqaedlavyyckqsynlytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'P':
    No sequence available.