PDB entry 3cjt

View 3cjt on RCSB PDB site
Description: Ribosomal protein L11 methyltransferase (PrmA) in complex with dimethylated ribosomal protein L11
Class: transferase/ribosomal protein
Keywords: S-Adenosyl-L-Methionine dependent methyltransferase, post-translational modification, multi-specific trimethylation, Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding, TRANSFERASE-RIBOSOMAL PROTEIN COMPLEX
Deposited on 2008-03-13, released 2008-05-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.198
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosomal protein L11 methyltransferase
    Species: Thermus thermophilus
    Gene: prmA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84BQ9 (0-253)
      • engineered (103)
  • Chain 'B':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus
    Gene: rplK, rpl11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3cjtb1, d3cjtb2
  • Chain 'C':
    Compound: Ribosomal protein L11 methyltransferase
    Species: Thermus thermophilus
    Gene: prmA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84BQ9 (0-253)
      • engineered (103)
  • Chain 'D':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus
    Gene: rplK, rpl11
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Ribosomal protein L11 methyltransferase
    Species: Thermus thermophilus
    Gene: prmA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84BQ9 (0-253)
      • engineered (103)
  • Chain 'F':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus
    Gene: rplK, rpl11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3cjtf1, d3cjtf2
  • Chain 'G':
    Compound: Ribosomal protein L11 methyltransferase
    Species: Thermus thermophilus
    Gene: prmA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84BQ9 (0-253)
      • engineered (103)
  • Chain 'H':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus
    Gene: rplK, rpl11
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Ribosomal protein L11 methyltransferase
    Species: Thermus thermophilus
    Gene: prmA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84BQ9 (0-253)
      • engineered (103)
  • Chain 'J':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus
    Gene: rplK, rpl11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3cjtj1, d3cjtj2
  • Chain 'K':
    Compound: Ribosomal protein L11 methyltransferase
    Species: Thermus thermophilus
    Gene: prmA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84BQ9 (0-253)
      • engineered (103)
  • Chain 'L':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus
    Gene: rplK, rpl11
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Ribosomal protein L11 methyltransferase
    Species: Thermus thermophilus
    Gene: prmA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84BQ9 (0-253)
      • engineered (103)
  • Chain 'N':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus
    Gene: rplK, rpl11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3cjtn1, d3cjtn2
  • Chain 'O':
    Compound: Ribosomal protein L11 methyltransferase
    Species: Thermus thermophilus
    Gene: prmA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84BQ9 (0-253)
      • engineered (103)
  • Chain 'P':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus
    Gene: rplK, rpl11
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NO3, CL, SAM, SAH, EDO, 2MM, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3cjtB (B:)
mkkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiy
adrsftfvtktppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdl
eaaarmiagsarsmgvevvgapevkda

    Sequence, based on observed residues (ATOM records): (download) 
    >3cjtB (B:)
kkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiya
drsftfvtktppasylirkaaglekgahkpgrekvgreiakqkmpleaaarmiagsarsm
gvevvg

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download) 
    >3cjtF (F:)
mkkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiy
adrsftfvtktppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdl
eaaarmiagsarsmgvevvgapevkda

    Sequence, based on observed residues (ATOM records): (download) 
    >3cjtF (F:)
kkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiya
drsftfvtktppasylirkaaglekghkpgrekvgreqvleiakqkmpleaaarmiagsa
rsmgvevvga

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download) 
    >3cjtJ (J:)
mkkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiy
adrsftfvtktppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdl
eaaarmiagsarsmgvevvgapevkda

    Sequence, based on observed residues (ATOM records): (download) 
    >3cjtJ (J:)
kkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiya
drsftfvtktppasylirkaaglekgahkpgrekvgreiakqkmpleaaarmiagsarsm
gvevvga

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence, based on SEQRES records: (download) 
    >3cjtN (N:)
mkkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiy
adrsftfvtktppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdl
eaaarmiagsarsmgvevvgapevkda

    Sequence, based on observed residues (ATOM records): (download) 
    >3cjtN (N:)
kkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiya
drsftfvtktppasylirkaaglekghkpgrekvgreqvleiakqkmpleaaarmiagsa
rsmgvevvga

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.