PDB entry 3cjs

View 3cjs on RCSB PDB site
Description: Minimal Recognition Complex between PrmA and Ribosomal Protein L11
Class: transferase/ribosomal protein
Keywords: S-Adenosyl-L-Methionine dependent methyltransferase, post-translational modification, multi-specific trimethylation, Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding, TRANSFERASE-RIBOSOMAL PROTEIN COMPLEX
Deposited on 2008-03-13, released 2008-05-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: 0.182
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosomal protein L11 methyltransferase
    Species: Thermus thermophilus
    Gene: prmA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus
    Gene: rplK, rpl11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cjsb1
  • Chain 'C':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus
    Gene: rplK, rpl11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cjsc1
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cjsB (B:)
    mkkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiy
    adrsftfvtktp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3cjsC (C:)
    mkkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiy
    adrsftfvtktp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cjsC (C:)
    kvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiyad
    rsftfvtk