PDB entry 3cjs
View 3cjs on RCSB PDB site
Description: Minimal Recognition Complex between PrmA and Ribosomal Protein L11
Class: transferase/ribosomal protein
Keywords: S-Adenosyl-L-Methionine dependent methyltransferase, post-translational modification, multi-specific trimethylation, Cytoplasm, Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding, TRANSFERASE/RIBOSOMAL PROTEIN COMPLEX
Deposited on
2008-03-13, released
2008-05-20
The last revision prior to the SCOP 1.75 freeze date was dated
2008-07-22, with a file datestamp of
2008-07-18.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: 0.182
AEROSPACI score: 0.82
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Ribosomal protein L11 methyltransferase
Species: Thermus thermophilus
Gene: prmA
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: 50S ribosomal protein L11
Species: Thermus thermophilus
Gene: rplK, rpl11
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d3cjsb1 - Chain 'C':
Compound: 50S ribosomal protein L11
Species: Thermus thermophilus
Gene: rplK, rpl11
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d3cjsc1 - Heterogens: EDO, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3cjsB (B:)
mkkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiy
adrsftfvtktp
- Chain 'C':
Sequence, based on SEQRES records: (download)
>3cjsC (C:)
mkkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiy
adrsftfvtktp
Sequence, based on observed residues (ATOM records): (download)
>3cjsC (C:)
kvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiyad
rsftfvtk