PDB entry 3cjr

View 3cjr on RCSB PDB site
Description: Ribosomal protein L11 methyltransferase (PrmA) in complex with ribosomal protein L11 (K39A) and inhibitor Sinefungin.
Class: transferase/ribosomal protein
Keywords: S-Adenosyl-L-Methionine dependent methyltransferase, post-translational modification, multi-specific trimethylation, Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding, TRANSFERASE-RIBOSOMAL PROTEIN COMPLEX
Deposited on 2008-03-13, released 2008-05-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.216
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosomal protein L11 methyltransferase
    Species: Thermus thermophilus
    Gene: prmA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cjra1
  • Chain 'B':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus
    Gene: rplK, rpl11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36238 (0-End)
      • engineered (38)
    Domains in SCOPe 2.04: d3cjrb1, d3cjrb2
  • Heterogens: SFG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cjrA (A:)
    mwvyrlkgtlealdpilpglfdggarglweregevwaffpapvdlpyegvweevgdedwl
    eawrrdlkpalappfvvlapwhtwegaeiplviepgmafgtghhettrlalkalarhlrp
    gdkvldlgtgsgvlaiaaeklggkalgvdidpmvlpqaeanakrngvrprflegsleaal
    pfgpfdllvanlyaelhaalapryrealvpggralltgilkdraplvreamagagfrple
    eaaegewvllaygr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cjrA (A:)
    mwvyrlkgtlealdpilpglfdggarglweregevwaffpapvdlpyegvweevleawrr
    dlkpalappfvvlapwhtwegaeiplviepgmafgtghhettrlalkalarhlrpgdkvl
    dlgtgsgvlaiaaeklggkalgvdidpmvlpqaeanakrngvrprflegsleaalpfgpf
    dllvanlyaelhaalapryrealvpggralltgilkdraplvreamagagfrpleeaaeg
    ewvllaygr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cjrB (B:)
    mkkvvavvklqlpagkatpappvgpalgqhganimefvaafnaatanmgdaivpveitiy
    adrsftfvtktppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdl
    eaaarmiagsarsmgvevvgapevkda
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cjrB (B:)
    mkkvvavvklqlpagkatpappvgpalgqhganimefvaafnaatanmgdaivpveitiy
    adrsftfvtktppasyliritweqvleiakqkmpdlnttdleaaarmiagsarsmgve