PDB entry 3cjo

View 3cjo on RCSB PDB site
Description: Crystal structure of KSP in complex with inhibitor 30
Class: motor protein
Keywords: KSP, KSP-inhibitor complex, ATP-binding, Cell cycle, Cell division, Coiled coil, Microtubule, Mitosis, Motor protein, Nucleotide-binding, Phosphoprotein
Deposited on 2008-03-13, released 2008-07-01
The last revision prior to the SCOP 1.75 freeze date was dated 2008-09-16, with a file datestamp of 2008-09-12.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.185
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein KIF11
    Species: HOMO SAPIENS
    Gene: KIF11, EG5, KNSL1, TRIP5
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3cjoa1
  • Chain 'B':
    Compound: Kinesin-like protein KIF11
    Species: HOMO SAPIENS
    Gene: KIF11, EG5, KNSL1, TRIP5
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3cjob1
  • Heterogens: MG, ADP, K30, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cjoA (A:)
    asqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladks
    srktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegersp
    neeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvser
    lqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsv
    tihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvita
    lvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahrakniln
    kpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cjoA (A:)
    niqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgastk
    qidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiip
    rtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviik
    gleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvk
    igklnlvdlagsenninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsi
    iatispaslnleetlstleyahraknilnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cjoB (B:)
    asqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladks
    srktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegersp
    neeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvser
    lqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsv
    tihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvita
    lvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahrakniln
    kpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cjoB (B:)
    niqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgastk
    qidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiip
    rtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviik
    gleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvk
    igklnlvdlagsenninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsi
    iatispaslnleetlstleyahraknilnk