PDB entry 3cjk

View 3cjk on RCSB PDB site
Description: Crystal structure of the adduct HAH1-Cd(II)-MNK1.
Class: metal transport/hydrolase
Keywords: HAH1; ATP7A; ATP7B; Menkes disease; metal homeostasis, Chaperone, Copper, Copper transport, Ion transport, Metal-binding, Transport, Alternative splicing, ATP-binding, Cytoplasm, Disease mutation, Endoplasmic reticulum, Glycoprotein, Golgi apparatus, Hydrolase, Magnesium, Membrane, Nucleotide-binding, Phosphoprotein, Polymorphism, Transmembrane, METAL TRANSPORT/HYDROLASE COMPLEX
Deposited on 2008-03-13, released 2008-12-30
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-08-11, with a file datestamp of 2009-08-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.231
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: copper transport protein atox1
  Species: Homo sapiens [TaxId:9606]
  Gene: ATOX1, HAH1
  Database cross-references and differences (RAF-indexed):
  • Uniprot O00244 (0-66)
    • expression tag (67)
  Domains in SCOPe 2.03: d3cjka_
• Chain 'B':
  Compound: Copper-transporting ATPase 1
  Species: Homo sapiens [TaxId:9606]
  Gene: ATP7A, MC1, MNK
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q04656 (0-70)
    • expression tag (71-74)
  Domains in SCOPe 2.03: d3cjkb_
• Heterogens: CD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3cjkA (A:)
  pkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgkt
  vsylglei
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3cjkB (B:)
  vnsvtisvegmtcnscvwtieqqigkvngvhhikvsleeknatiiydpklqtpktlqeai
  ddmgfdavihniegr