PDB entry 3cjk

View 3cjk on RCSB PDB site
Description: Crystal structure of the adduct HAH1-Cd(II)-MNK1.
Class: metal transport/hydrolase
Keywords: HAH1; ATP7A; ATP7B; Menkes disease; metal homeostasis, Chaperone, Copper, Copper transport, Ion transport, Metal-binding, Transport, Alternative splicing, ATP-binding, Cytoplasm, Disease mutation, Endoplasmic reticulum, Glycoprotein, Golgi apparatus, Hydrolase, Magnesium, Membrane, Nucleotide-binding, Phosphoprotein, Polymorphism, Transmembrane, METAL TRANSPORT/HYDROLASE COMPLEX
Deposited on 2008-03-13, released 2008-12-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-08-11, with a file datestamp of 2009-08-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.231
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: copper transport protein atox1
    Species: Homo sapiens [TaxId:9606]
    Gene: ATOX1, HAH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00244 (0-66)
      • expression tag (67)
    Domains in SCOPe 2.08: d3cjka1, d3cjka2
  • Chain 'B':
    Compound: Copper-transporting ATPase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ATP7A, MC1, MNK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04656 (0-70)
      • expression tag (71-74)
    Domains in SCOPe 2.08: d3cjkb1, d3cjkb2
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cjkA (A:)
    pkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgkt
    vsylglei
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cjkB (B:)
    vnsvtisvegmtcnscvwtieqqigkvngvhhikvsleeknatiiydpklqtpktlqeai
    ddmgfdavihniegr