PDB entry 3ciu

View 3ciu on RCSB PDB site
Description: Site-Selective Glycosylation of Cysteine-93 beta on the Surface of Bovine Hemoglobin and its Application as a Novel Oxygen Therapeutic
Class: oxygen binding
Keywords: Hemoglobin, glycosylation, site-selective, oxygen carrier, blood substitute, Heme, Iron, Oxygen transport, Polymorphism, Transport, OXYGEN BINDING
Deposited on 2008-03-11, released 2008-04-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.271
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha
    Species: Bos taurus [TaxId:9913]
    Gene: HBA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ciua1
  • Chain 'B':
    Compound: Hemoglobin subunit beta
    Species: Bos taurus [TaxId:9913]
    Gene: HBB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ciub1
  • Chain 'C':
    Compound: Hemoglobin subunit alpha
    Species: Bos taurus [TaxId:9913]
    Gene: HBA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ciuc1
  • Chain 'D':
    Compound: Hemoglobin subunit beta
    Species: Bos taurus [TaxId:9913]
    Gene: HBB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ciud1
  • Heterogens: HEM, O, 5DP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ciuA (A:)
    vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
    kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
    vhasldkflanvstvltskyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ciuA (A:)
    lsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghgak
    vaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpav
    hasldkflanvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ciuB (B:)
    mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
    ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
    ftpvlqadfqkvvagvanalahryh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ciuC (C:)
    vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
    kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
    vhasldkflanvstvltskyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ciuD (D:)
    mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
    ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
    ftpvlqadfqkvvagvanalahryh