PDB entry 3ciq

View 3ciq on RCSB PDB site
Description: A regulatable switch mediates self-association in an immunoglobulin fold
Class: immune system
Keywords: class-1 MHC, amyloid, protein folding, dialysis-related amyloidosis, beta-2 microglobulin, Disease mutation, Glycation, Glycoprotein, Immune response, Immunoglobulin domain, MHC I, Pyrrolidone carboxylic acid, Secreted, IMMUNE SYSTEM
Deposited on 2008-03-11, released 2008-09-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.227
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • initiating methionine (0)
      • engineered (13)
    Domains in SCOPe 2.03: d3ciqa_
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • initiating methionine (0)
      • engineered (13)
    Domains in SCOPe 2.03: d3ciqb_
  • Chain 'C':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • initiating methionine (0)
      • engineered (13)
    Domains in SCOPe 2.03: d3ciqc_
  • Chain 'D':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • initiating methionine (0)
      • engineered (13)
    Domains in SCOPe 2.03: d3ciqd_
  • Chain 'E':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • initiating methionine (0)
      • engineered (13)
    Domains in SCOPe 2.03: d3ciqe_
  • Chain 'F':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • initiating methionine (0)
      • engineered (13)
    Domains in SCOPe 2.03: d3ciqf_
  • Chain 'G':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • initiating methionine (0)
      • engineered (13)
    Domains in SCOPe 2.03: d3ciqg_
  • Chain 'H':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • initiating methionine (0)
      • engineered (13)
    Domains in SCOPe 2.03: d3ciqh_
  • Chain 'I':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • initiating methionine (0)
      • engineered (13)
    Domains in SCOPe 2.03: d3ciqi_
  • Chain 'J':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • initiating methionine (0)
      • engineered (13)
    Domains in SCOPe 2.03: d3ciqj_
  • Chain 'K':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • initiating methionine (0)
      • engineered (13)
    Domains in SCOPe 2.03: d3ciqk_
  • Chain 'L':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • initiating methionine (0)
      • engineered (13)
    Domains in SCOPe 2.03: d3ciql_
  • Heterogens: CU, TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ciqA (A:)
    miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ciqA (A:)
    miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ciqB (B:)
    miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ciqB (B:)
    miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ciqC (C:)
    miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ciqC (C:)
    miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ciqD (D:)
    miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ciqD (D:)
    miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ciqE (E:)
    miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ciqE (E:)
    miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ciqF (F:)
    miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ciqF (F:)
    miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3ciqG (G:)
    miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ciqG (G:)
    miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ciqH (H:)
    miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ciqH (H:)
    miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkniekvehsdlsfskdwsf
    yllyyteftptekdeyacrvnhvtlsqpkivkwdr
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3ciqI (I:)
    miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ciqI (I:)
    miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3ciqJ (J:)
    miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ciqJ (J:)
    miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3ciqK (K:)
    miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ciqK (K:)
    miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3ciqL (L:)
    miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ciqL (L:)
    miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdr