PDB entry 3cin

View 3cin on RCSB PDB site
Description: crystal structure of a myo-inositol-1-phosphate synthase-related protein (tm_1419) from thermotoga maritima msb8 at 1.70 a resolution
Class: isomerase
Keywords: myo-inositol-1-phosphate synthase-related protein, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, isomerase
Deposited on 2008-03-11, released 2008-03-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myo-inositol-1-phosphate synthase-related protein
    Species: Thermotoga maritima [TaxId:243274]
    Gene: TM1419, TM_1419
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1D6 (12-End)
      • leader sequence (11)
    Domains in SCOPe 2.08: d3cina1, d3cina2, d3cina3
  • Heterogens: CL, MG, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cinA (A:)
    mgsdkihhhhhhmvkvlilgqgyvastfvagleklrkgeiepygvplarelpigfediki
    vgsydvdrakigkklsevvkqywndvdsltsdpeirkgvhlgsvrnlpieaegledsmtl
    keavdtlvkewteldpdvivntctteafvpfgnkedllkaienndkerltatqvyayaaa
    lyankrggaafvnviptfiandpafvelakennlvvfgddgatgatpftadvlshlaqrn
    ryvkdvaqfniggnmdflaltddgknkskeftkssivkdilgydaphyikptgyleplgd
    kkfiaihieyvsfngatdelmingrindspalggllvdlvrlgkialdrkefgtvypvna
    fymknpgpaeeknipriiayekmriwaglkpkwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cinA (A:)
    hmvkvlilgqgyvastfvagleklrkgeiepygvplarelpigfedikivgsydvdraki
    gkklsevvkqywndvdsltsdpeirkgvhlgsvrnlpieaegledsmtlkeavdtlvkew
    teldpdvivntctteafvpfgnkedllkaienndkerltatqvyayaaalyankrggaaf
    vnviptfiandpafvelakennlvvfgddgatgatpftadvlshlaqrnryvkdvaqfni
    ggnmdflaltddgknkskeftkssivkdilgydaphyikptgyleplgdkkfiaihieyv
    sfngatdelmingrindspalggllvdlvrlgkialdrkefgtvypvnafymknpgpaee
    knipriiayekmriwaglkpkw