PDB entry 3ci9

View 3ci9 on RCSB PDB site
Description: crystal structure of the human hsbp1
Deposited on 2008-03-11, released 2009-01-20
The last revision was dated 2021-11-10, with a file datestamp of 2021-11-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock factor-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HSBP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75506 (0-47)
      • engineered mutation (24)
  • Chain 'B':
    Compound: Heat shock factor-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HSBP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75506 (0-47)
      • engineered mutation (24)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ci9A (A:)
pktvqdltsvvqtllqqmqdkfqtisdqiigriddmssriddleknia

    Sequence, based on observed residues (ATOM records):
    >3ci9A (A:)
pktvqdltsvvqtllqqmqdkfqtisdqiigriddmssriddle

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3ci9B (B:)
pktvqdltsvvqtllqqmqdkfqtisdqiigriddmssriddleknia

    Sequence, based on observed residues (ATOM records):
    >3ci9B (B:)
vqdltsvvqtllqqmqdkfqtisdqiigriddmssriddleknia