PDB entry 3ci7

View 3ci7 on RCSB PDB site
Description: Crystal structure of a simplified BPTI containing 20 alanines
Deposited on 2008-03-11, released 2008-10-21
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.157
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bovine pancreatic trypsin inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3CI7 (0-57)
  • Chain 'B':
    Compound: bovine pancreatic trypsin inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3CI7 (0-End)
  • Chain 'C':
    Compound: bovine pancreatic trypsin inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3CI7 (0-57)
  • Chain 'D':
    Compound: bovine pancreatic trypsin inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3CI7 (0-End)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3ci7A (A:)
rpafcleppyagpgkariiryfynaaagaaqafvyggarakrnnfasaadalaacaaa

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3ci7B (B:)
rpafcleppyagpgkariiryfynaaagaaqafvyggarakrnnfasaadalaacaaa

    Sequence, based on observed residues (ATOM records):
    >3ci7B (B:)
rpafcleppyagpgkariiryfynaaagaaqafvyggarakrnnfasaadalaaca

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >3ci7C (C:)
rpafcleppyagpgkariiryfynaaagaaqafvyggarakrnnfasaadalaacaaa

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3ci7D (D:)
rpafcleppyagpgkariiryfynaaagaaqafvyggarakrnnfasaadalaacaaa

    Sequence, based on observed residues (ATOM records):
    >3ci7D (D:)
rpafcleppyagpgkariiryfynaaagaaqafvyggarakrnnfasaadalaacaa