PDB entry 3ci2

View 3ci2 on RCSB PDB site
Description: refinement of the three-dimensional solution structure of barley serine proteinase inhibitor 2 and comparison with the structures in crystals
Class: serine protease inhibitor
Keywords: serine protease inhibitor
Deposited on 1991-09-10, released 1993-10-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: chymotrypsin inhibitor 2
  Species: Hordeum vulgare [TaxId:4513]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01053 (Start-65)
  Domains in SCOPe 2.03: d3ci2a_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3ci2A (A:)
  hnlktewpelvgksveeakkvilqdkpeaqiivlpvgtivtmeyridrvrlfvdkldnia
  qvprvg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3ci2A (A:)
  lktewpelvgksveeakkvilqdkpeaqiivlpvgtivtmeyridrvrlfvdkldniaqv
  prvg