PDB entry 3ci2

View 3ci2 on RCSB PDB site
Description: refinement of the three-dimensional solution structure of barley serine proteinase inhibitor 2 and comparison with the structures in crystals
Class: serine protease inhibitor
Keywords: serine protease inhibitor
Deposited on 1991-09-10, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chymotrypsin inhibitor 2
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3ci2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ci2A (A:)
    hnlktewpelvgksveeakkvilqdkpeaqiivlpvgtivtmeyridrvrlfvdkldnia
    qvprvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ci2A (A:)
    lktewpelvgksveeakkvilqdkpeaqiivlpvgtivtmeyridrvrlfvdkldniaqv
    prvg