PDB entry 3chb

View 3chb on RCSB PDB site
Description: cholera toxin b-pentamer complexed with gm1 pentasaccharide
Deposited on 1998-03-24, released 1998-08-12
The last revision prior to the SCOP 1.65 freeze date was dated 1998-08-12, with a file datestamp of 1998-08-12.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.1326
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Domains in SCOP 1.65: d3chbd_
  • Chain 'E':
    Domains in SCOP 1.65: d3chbe_
  • Chain 'F':
    Domains in SCOP 1.65: d3chbf_
  • Chain 'G':
    Domains in SCOP 1.65: d3chbg_
  • Chain 'H':
    Domains in SCOP 1.65: d3chbh_

PDB Chain Sequences:

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3chbD (D:)
    mtpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhid
    sqkkaiermkdtlriaylteakveklcvwnnktpraiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >3chbD (D:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktpraiaaisman
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3chbE (E:)
    mtpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhid
    sqkkaiermkdtlriaylteakveklcvwnnktpraiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >3chbE (E:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktpraiaaisman
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3chbF (F:)
    mtpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhid
    sqkkaiermkdtlriaylteakveklcvwnnktpraiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >3chbF (F:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktpraiaaisman
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3chbG (G:)
    mtpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhid
    sqkkaiermkdtlriaylteakveklcvwnnktpraiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >3chbG (G:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktpraiaaisman
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3chbH (H:)
    mtpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhid
    sqkkaiermkdtlriaylteakveklcvwnnktpraiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >3chbH (H:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktpraiaaisman