PDB entry 3ch7

View 3ch7 on RCSB PDB site
Description: crystal structure of 6-phosphogluconolactonase from leishmania braziliensis
Deposited on 2008-03-07, released 2008-03-18
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phosphogluconolactonase
    Species: Leishmania braziliensis [TaxId:420245]
    Gene: Lbra003394AAA, LbrM26_V2.2630
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4HFB4 (0-265)
      • variant (133)
      • variant (209)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3ch7A (A:)
tsfaptvkicenlsqmsfaarevilaaidarvdksvpvvlalsggstpkrlyeelhekdl
allqqhavqfilgderllseddeqsnfsmatkallrdvpssdvisidrraalatskdekg
gldgawavaqdyevkllnclpckqingtaksvpvvdivllgfgsdghtasifpdsvaatd
eehvvsvsfpsptmspkvwrvtlsktviqyakhvvvlaagkdknwvvrgvlsesptdplp
vsrflrdcrgsvtllldpgagegvca