PDB entry 3ch1

View 3ch1 on RCSB PDB site
Description: Crystal structure of H-2Db in complex with chimeric gp100
Class: immune system
Keywords: MHC, H-2Db, Glycoprotein, Immune response, Membrane, MHC I, Transmembrane, Immunoglobulin domain, Secreted, Disease mutation, Melanin biosynthesis, IMMUNE SYSTEM
Deposited on 2008-03-06, released 2009-03-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.233
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-D1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3ch1b_
  • Chain 'C':
    Compound: nonameric peptide chimeric gp100
    Database cross-references and differences (RAF-indexed):
    • PDB 3CH1 (0-8)
  • Chain 'D':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-D1
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3ch1e_
  • Chain 'F':
    Compound: nonameric peptide chimeric gp100
    Database cross-references and differences (RAF-indexed):
    • PDB 3CH1 (0-8)
  • Chain 'G':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-D1
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3ch1h_
  • Chain 'I':
    Compound: nonameric peptide chimeric gp100
    Database cross-references and differences (RAF-indexed):
    • PDB 3CH1 (0-8)
  • Chain 'J':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-D1
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3ch1k_
  • Chain 'L':
    Compound: nonameric peptide chimeric gp100
    Database cross-references and differences (RAF-indexed):
    • PDB 3CH1 (0-8)
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ch1B (B:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ch1E (E:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ch1H (H:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ch1K (K:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

  • Chain 'L':
    No sequence available.