PDB entry 3cgt

View 3cgt on RCSB PDB site
Description: structure of cyclodextrin glycosyltransferase complexed with its main product beta-cyclodextrin
Class: glycosyltransferase
Keywords: glycosyltransferase, starch degradation, cyclodextrin
Deposited on 1998-01-22, released 1998-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.177
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclodextrin glycosyltransferase
    Species: Bacillus circulans [TaxId:1397]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30920 (0-683)
      • engineered (256)
    Domains in SCOPe 2.07: d3cgta1, d3cgta2, d3cgta3, d3cgta4
  • Heterogens: BCD, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cgtA (A:)
    dpdtavtnkqsfstdviyqvftdrfldgnpsnnptgaaydatcsnlklycggdwqglink
    indnyfsdlgvtalwisqpvenifatinysgvtntayhgywardfkktnpyfgtmadfqn
    littahakgikividfapnhtspametdtsfaengrlydngtlvggytndtngyfhhngg
    sdfsslengiyknlydladfnhnnatidkyfkdaiklwldmgvdgirvdavkhmplgwqk
    swmssiyahkpvftfgawflgsaasdadntdfanksgmslldfrfnsavrnvfrdntsnm
    yaldsminstatdynqvndqvtfidnhdmdrfktsavnnrrleqalaftltsrgvpaiyy
    gteqyltgngdpdnrakmpsfsksttafnvisklaplrksnpaiaygstqqrwinndvyv
    yerkfgksvavvavnrnlstsasitglstslptgsytdvlggvlngnnitstngsinnft
    laagatavwqyttaettptighvgpvmgkpgnvvtidgrgfgstkgtvyfgttavtgaai
    tswedtqikvtipsvaagnyavkvaasgvnsnaynnftiltgdqvtvrfvvnnasttlgq
    nlyltgnvaelgnwstgstaigpafnqvihqyptwyydvsvpagkqlefkffkkngstit
    wesgsnhtfttpasgtatvtvnwq