PDB entry 3cga

View 3cga on RCSB PDB site
Description: Crystal structure of metastasis-associated protein S100A4 in the active, calcium-bound form
Class: metal binding protein
Keywords: calcium-binding, METAL BINDING PROTEIN
Deposited on 2008-03-05, released 2008-09-30
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.255
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A4
    Species: HOMO SAPIENS
    Gene: S100A4, CAPL, MTS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3cgaa_
  • Chain 'B':
    Compound: Protein S100-A4
    Species: HOMO SAPIENS
    Gene: S100A4, CAPL, MTS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3cgab_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cgaA (A:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cgaA (A:)
    plekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsnld
    snrdnevdfqeycvflsciammcneff
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cgaB (B:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cgaB (B:)
    plekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsnld
    snrdnevdfqeycvflsciammcneff