PDB entry 3cg5

View 3cg5 on RCSB PDB site
Description: Crystal Structure of the Covalent Adduct Formed between TB B-lactamase and Clavulanate
Deposited on 2008-03-04, released 2008-05-27
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.181
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Mycobacterium tuberculosis
    Gene: blaA, blaC
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PO4, ISS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3cg5A (A:)
dladrfaelerrydarlgvyvpatgttaaieyraderfafcstfkaplvaavlhqnplth
ldklitytsddirsispvaqqhvqtgmtigqlcdaairysdgtaanllladlggpgggta
aftgylrslgdtvsrldaeepelnrdppgderdtttphaialvlqqlvlgnalppdkral
ltdwmarnttgakriragfpadwkvidktgtgdygrandiavvwsptgvpyvvavmsdra
gggydaepreallaeaatcvagvla